SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016346 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPFOP00000016346
Domain Number - Region: 288-343
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000798
Family Pentapeptide repeats 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016346   Gene: ENSPFOG00000016289   Transcript: ENSPFOT00000016368
Sequence length 669
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519625.1:3293743:3299191:-1 gene:ENSPFOG00000016289 transcript:ENSPFOT00000016368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPNSVPSDLYKCVYSFLLENKFTKAAQQFLKQTKVIPQDQNEESLVSIYNFWVKSPEA
RKRKAASASVNGPSAKKARPSAESSSSEDSSDSEEEKKTPAKTALKAAPAAAPGSSTRKK
DSSSSSEESDSEDEQPAKAPAASILFLITEAVTAAKAAASAKKKQESSSEDSSSDSEDEP
PAKVNDKAAAPGNKAAAPGNKAAAPAESSSEDSSSEDETPPSKKPKPGPYSAVPPPASIQ
KAPAAAAKTAAKPAATKPAAKKQESSSESSDSSSDEEEAKKPAAKATLAKATPAKATLAK
ATLAKATPAKATLAKATLAKATPAKATLAKATLAKATPAKATLAKAEDSEEDSSSDEEEE
GVKKPAAKTPPAKPAAVKAAPTKAAAPITPAKKDSSSSSEDSSSEEEQKAVKKPPPAKTA
AAKAVTPKTQPAASKPPAKAAETSSDSEDSSDEEDEPPKSKPAAKPAAKPAKPAAAAESS
SDSDSSDEEEEPAKAKPASKPATPAAGASKPATPAGKPAASSESSSDSSSEDEEPAKAKP
TATKASXPAAGKATKPAAVKKAEESSSDSSDSSDSEEEAPPAKPAATNGKAATPKAAATV
AKAAGKPAESSSSDSSSEEEAVSKTSQVKAPAAAAKNKTVAAAKAEESSSSSDSSSEDEA
PRKAATAPP
Download sequence
Identical sequences ENSPFOP00000016346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]