SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016908 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016908
Domain Number 1 Region: 353-490
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-40
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 2 Region: 942-1091
Classification Level Classification E-value
Superfamily C-type lectin-like 9.96e-38
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1216-1356
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-35
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 4 Region: 643-785
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-34
Family C-type lectin domain 0.0000774
Further Details:      
 
Domain Number 5 Region: 792-925
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-34
Family C-type lectin domain 0.00066
Further Details:      
 
Domain Number 6 Region: 1087-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-32
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 7 Region: 502-636
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 225-354
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-31
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 9 Region: 24-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.13e-30
Family Cysteine rich domain 0.0000216
Further Details:      
 
Domain Number 10 Region: 160-216
Classification Level Classification E-value
Superfamily Kringle-like 6e-18
Family Fibronectin type II module 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016908   Gene: ENSPFOG00000016777   Transcript: ENSPFOT00000016930
Sequence length 1453
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519681.1:2344220:2355492:-1 gene:ENSPFOG00000016777 transcript:ENSPFOT00000016930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLSTFALILCLLQALHIKADIDSGIFLIFNQNHNKCIKVESASSVILAQCNPRASEQQ
FRWVSESRLLSLSLKLCLGATAIKDWVKVLLFECDESSSLQHWQCKNETLFGLKDQDLHL
NWGNFKEKNVMIYKGAGEWSRWKIFGTQGDLCSKGFQGSETFTIRGNAFGAPCQFPFKYT
SKWYAECTTDGRTDGQLWCATEKDYHTNTKFGFCPTKGSIGWDTDPVTRVQYQRNTQATL
TWHQARVSCQQQGADLLSIVELHEQSYISDKGLTNHLGTSLWIGLNSLDFESGWQWSNGN
PFRYLNWAPGNPSSVPGESCAILNTRKASKWESSICSKKLGYICRKGNSTSLPPPPDKGP
SFCPSHWVPYGGQCYYLERSKKMWRDALAACHKEEADLASISNIEEQSFIITQSGYLQTD
VLWIGLNDQRNPMLFEWSDRSHVTFTNWQSDEPSHATNHQEDCVLIRGKEGKWADHMCEK
TYGYICKKKASTKPTGGTQEEVNPGCKLGTTRFGSYCYEIGRETKSFEEAMQACSKGGSN
LVDIADRYENAFLISLVGLRPERYFWTGLTNTEEINVFKWTTRRQVTFTHFNVGMPDRKQ
GCVAMTTGTFAGLWDVISCSNKEKYICKKKAEGVLATTVQPTTPQLSCASGWTPVAKRNV
CYKKVYKKMKENKKTWQEAQDFCKAIGGNLISLLSMRDLDNVNFYSSDPVWIGLRVMGPN
QGFVWSDGSPFSFENWGFGEPNNHNDNEHCAEVHFHYSRHWNDRNCDSYNDWICQIRKGV
TPKPEPVFVVEVFNTTEDGWLIYNDSHYYINKNKLPMEAARDYCKKNFGELAVITGESER
KFLWKHLTRDPQAQNHAQYYIGLIVNLDQSFSWVDGTPVTYTAWENNEPNFANNDENCVT
MYSSMGYWNDINCGLELPSICKRRGSFINTTMAPTTPPKGGCAPEWLNFKGKTQCYKFFA
DKKNWKDARTHCQKEGGNLVSITSEREQAFLTTQMLSQKEDLWLGMNDINWEMHFVWTDG
KAISFTNWAKGHPISTPDGRFFLDEVFDCVIMVGSILKIKGQWKVEDCSEKRGFVCKKNV
DSQIAVPATTVSPKSFYKIGNDSYKVVAQKMRWDEARRQCQADDSELASILNPMIQAFVT
LQISTLKEPVWIGLNNNVTGGRFKWVDNWLLSYTKWGKNEPKNYGCVYIDVDHTWKTAEC
SSTYYSICKRSQDLAPTEPPQLPGNCPEPKKDRSWMPFRGHCYYFVGSVVDNWAHASVEC
MKLGASLVSIQDPVEAKFIQKNIESLQDETKSFWIGLYKSHDDEWMWIDNSVVDYTNWII
GMPKSDSCVNIHSDSGKWSTNSCSRYRSYICKRPKVIPPTSKPQFVGNSVSLAVQTVKEA
SLHGSAGITVAIVLIVIAIVGLAAFLLFRKRIRLPMATLAECTFDNKLYFNNPNRVPVDT
KGLVVNIEQNEQA
Download sequence
Identical sequences ENSPFOP00000016908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]