SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000016935 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000016935
Domain Number 1 Region: 186-525
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.74e-74
Family Protein kinases, catalytic subunit 0.00000548
Further Details:      
 
Domain Number 2 Region: 31-181
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.16e-33
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000016935   Gene: ENSPFOG00000016873   Transcript: ENSPFOT00000016957
Sequence length 557
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519840.1:347425:353418:-1 gene:ENSPFOG00000016873 transcript:ENSPFOT00000016957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDMGGLDNLVANTAYLKAQGGDDKEMKKRRRSLSLPKPEQCAAIRAAIDKDFTFICERQ
PIGKKLFRDFLSSTPEFKLAAEFLDELYDWDLAEGATKEKARQEIMKKYCKADSKSFLTF
LTGEPAEKCKSVTDANFEEVMKTQVQDGVREFLKGKPFTDYQDSPFFDKFLQWKEYEKQP
ISDKYFYEFRTLGKGGFGEVCAVQVKNTGQMYACKKLCKKRLKKKGGEKMALLEKQILEK
VNSLFLVNLAYAYDTKTHLCLVMTLMNGGDLKYHIYNIGYDGKGADKGIEMKRIIHYTAQ
IATGILHLHAMDIVYRDMKPENVLLDSQGQCRLSDLGLAIEVLPGKTVTQMAGTGAYMAP
EILSKTPYRTSVDWWALGCSIYEMVAGYTPFKGPESKKEKVEKEEVQRRILNEEPKWEHK
CFDAPTKDIIQQFLKKKIDERLGMRNNMEDPRKHEWFKTINFPRLEAGLVDPPWVPKPNV
VYAKDTGDIAEFSEIKGIEFDAKDDKFFKEFSTGAVPIPWQQEMIDTGLYDELSDPNRKE
GGGGLDDDKKSGTCALL
Download sequence
Identical sequences A0A087YFY2
XP_007568777.1.10163 XP_014915994.1.100837 ENSPFOP00000016935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]