SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000017393 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000017393
Domain Number 1 Region: 161-506
Classification Level Classification E-value
Superfamily Cullin repeat-like 2.3e-117
Family Cullin repeat 0.0000000000459
Further Details:      
 
Domain Number 2 Region: 508-781
Classification Level Classification E-value
Superfamily Cullin homology domain 1.83e-99
Family Cullin homology domain 0.00000000047
Further Details:      
 
Domain Number 3 Region: 777-865
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2e-27
Family SCF ubiquitin ligase complex WHB domain 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000017393   Gene: ENSPFOG00000017232   Transcript: ENSPFOT00000017415
Sequence length 865
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519854.1:770653:789699:1 gene:ENSPFOG00000017232 transcript:ENSPFOT00000017415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VANHLYSPASNNKKETRLQIREALSLSSPNPPPPPTQEARPAATDVKSDSGNITSPKKRK
INGSERDDTSDTMHIQKKLRFEDSVDFIGLDVKMAEEAAAAAAAASCSNNKSKAMFLAGG
VGGHHANGLTKTAGSGTFSSSKPGAAKKLVIKNFREKPKLPENYTQETWQKLKEAVEAIQ
NSTSIKYNLEELYQAVENLCSHKISAKLYKQLRTVCEDHIKAQIDQFRDALDSVLFLKKI
DKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRFYIISDLKVQSKTIDG
ILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQRLMQERE
VPEYLHHVNKRLEEEADRVITYLDQSTQKPLIATMEKQLLGEHLTAILQKGLTHLLDENR
IQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHI
IDICFLKNEKFVNAMKEAFETFINKRPNKPAELIAKHVDSKLRAGNKEATDEELEKMLDK
IMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMF
KDMELSKDIMVQFKQYMQCQNIPGNIELTVNILTMGYWPTYVPMEVHLPPEMVRLQEIFK
TFYLGKHSGRKLQWQSTLGHCVLKAEFKEKGKKELQVSLFQTLVLLMFNEGEEFTLEEIK
VATGIEDSELRRTLQSLACGKARVLTKIPKSKDVEDGDKFSCNDDFKHKLFRIKINQIQM
KETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLMSEVYNQLKFPVKPADLKK
RIESLIDRDYMERDKENSNQYNYVA
Download sequence
Identical sequences ENSPFOP00000017393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]