SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000017537 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000017537
Domain Number 1 Region: 71-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-76
Family Protein kinases, catalytic subunit 0.0000131
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00077
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000017537
Domain Number - Region: 362-434
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00294
Family Regulator of G-protein signaling, RGS 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000017537   Gene: ENSPFOG00000017426   Transcript: ENSPFOT00000017559
Sequence length 1017
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519741.1:1274136:1287284:1 gene:ENSPFOG00000017426 transcript:ENSPFOT00000017559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTAVFDYEATADDELSLHRGDLVEVLSKDSLVSGDEGWWTGMIADRVGIFPSNYVSKRNG
TEEEAGLRESSEHPVPPLHLLEIDFLELTLEEIIGVGGFGKVYRAVWRDVEVAVKAARRD
PDEDVAQTLESVRQEAKLFAMLNHPNIMALLGVCLQEPNLCLIMEYARGGPLNRALAGKR
IPPCTLVNWAVQIARGMHYLHDQAIVPIIHRDLKSSNILILERVEMEDLSNKTLKITDFG
LAREWHRTTKMSAAGTYAWMAPEVIRSSTFSKGSDVWSYGVLLWELLTGEVPFRTIDGLA
VAYGVAMNKLALPIPSTCPEPFARLMENCWSPDPHSRPLFTTILDQLTAIEESGFFEMPA
ESFHSLQDDWKLEIQEMFDQLRTKEKELRSWEEELTQAALQQKCQEEALRKREQELAERE
IHIVERELNIIIHQLYQEKPRVESRQGKFRRNRLKLKDGNRISLPSDFQHKITVQASPSH
DHRRSLLSSGSSPPTSPLMLPRLRAIQQDQGQKSELCGKKIFSVTPGEACTELERKGSRK
KGRSRGCGVYREHSADASHSAKPPHEGSRQRSCSAPNLRRSPRHSPAVPGVPSLLEAVEN
EDCCFTTEPGAAPGQSYLCIPFQKDANASSSLEHDGDEYCLSGQVPGTPPCRKSPGGGRR
SELVLLGCGALLAAVGLGCNLLTLAQPEEGIKSRWDAFFHRTGGQRRSTNSPTRRLFHRE
SPLKSSAPSLPERGLPSSYTLLSLSSVSDSNSTHSLLRSDSDELLICRPASAASRPPAPP
PLSQRRAPVQTPVNSLVNVHVESFKRNPRQSLTPTHVPCVPPSARSLRRTPSDGAIKKNG
PSSSLEPLPEKTTSSELPPDRAALPSSAPSDQPAAFSKHLVGLRISFNSSRWLQGFKRRL
SERPKTLDFVARPRPSPRPRCDVFWGDSRVRANGQTLGSGESPAYTSSTETPPTVEFGRD
SAVLPTPMEAPTPFSPRRNANLLDESDEGQYRDGTVPLCRPEFSLPKDSPYHPGFWS
Download sequence
Identical sequences ENSPFOP00000017537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]