SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000017731 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000017731
Domain Number 1 Region: 194-417
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.88e-49
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.053
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.71e-39
Family Interferon regulatory factor 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000017731   Gene: ENSPFOG00000017639   Transcript: ENSPFOT00000017753
Sequence length 439
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519643.1:2717158:2720194:1 gene:ENSPFOG00000017639 transcript:ENSPFOT00000017753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSGGRRLKQWLMEQIQSAQYSGLQWEDESRTMFRIPWKHAGKQDYNQEVDASIFKAWA
VFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTERSQLDISEPYKVYRIVPEEEQKHG
KIPVITMTGPTSSGDHTDMACSPTEIEELIKEVQNCLSLHHRHMQTAEDGCSIQASPEYW
PQSSMNAFSLHQDPMPSGNVNSGFSQLMISFYYGGKLMYNTLVTHPEGCRISPQQHLGRG
APYSSDSMQNIHFPPAELIEYERQRYFTRKLLGHLERGVLVRANQEGIFIKRLCQSRVFC
SGLGDGSSQYGSMPWKLERDSVVKIFDTGRFFQALQLYQEGQIAAPDPSVTLCFGEELND
VSSAKSKLIILQQQITMVNCQHMLESLNMRRSQPYTSSPNVEMSDDVATEQMARIYQDLC
SYSVPQRPACYRDNMPITA
Download sequence
Identical sequences ENSPFOP00000017731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]