SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018007 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018007
Domain Number 1 Region: 309-436
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.11e-42
Family Regulator of G-protein signaling, RGS 0.0000365
Further Details:      
 
Domain Number 2 Region: 6-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-27
Family DEP domain 0.018
Further Details:      
 
Domain Number 3 Region: 232-298
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000000196
Family Transducin (heterotrimeric G protein), gamma chain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018007   Gene: ENSPFOG00000017826   Transcript: ENSPFOT00000018029
Sequence length 475
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519611.1:2078341:2097966:1 gene:ENSPFOG00000017826 transcript:ENSPFOT00000018029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSQFLLCFSPQIEDIVTLIQDETEGVPIRTVKSFMTKIPSVVTGADIVQWLMKNLSIED
PAEAMHIGSLIAAQGYFFPISDHVLCLKDDGTLYRFQAPYFWPSNCWEPENTDYAIYLCK
RTMQNKTRLELADYEAENLARLQRAFARKWEFIYMQAEAQVKIDRKKDKTERKILDSQER
AFWDVHRPVPGCVNTTEMDIRKCRRMKNPHRVKKSVYGVVEEGTQAQSPIHTSLHHCRKG
TKEDVEKEILFLNTQLDRHCLKMSKVAESSLITYTEQFMEYDPFVTTPEPSNPWTSDDPS
LWDLEMSKEPSQQRVKKWGFSLEEALKDPAGQDLFLKFLESEFSSENLRFWLAVQGLKKV
PQQDVVQRVQDIWAEFLAEGAPSSINLDSHSYEITSQNLKDPGRYSYEDAQDHIYKLMKS
DSYPRFLRSNVYQDLLMARKKPETEQGRRTSLEKFTRSVGKSLTGKRLTGLMQSS
Download sequence
Identical sequences ENSPFOP00000018007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]