SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018016 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018016
Domain Number 1 Region: 294-369
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000109
Family PCI domain (PINT motif) 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000018016
Domain Number - Region: 105-211
Classification Level Classification E-value
Superfamily TPR-like 0.0038
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number - Region: 35-114,197-298
Classification Level Classification E-value
Superfamily ARM repeat 0.0311
Family B56-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018016   Gene: ENSPFOG00000017905   Transcript: ENSPFOT00000018038
Sequence length 423
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519614.1:4108261:4119254:1 gene:ENSPFOG00000017905 transcript:ENSPFOT00000018038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALEQFVNNVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDIQEHSLGVLA
VLFVKFSMPNIPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRG
VVILKQAIDKMQMNTNQLTSVHADLCQLCLLAKCFKPALPFLEVDMMDICKENGAYDAKH
FLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLEAYKKYILVSLILHGKVQQ
LPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPAELRSLVNKHNETFTRDNNTGLVKQCLS
SLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIYASINQKDGMVCF
HDNPEKYNNPAMLHKIDQEMLKCIELDEKLKSMDQEITVNPQFVQKSMGSQEDDVGSKTS
SYS
Download sequence
Identical sequences A0A087YJ13
ENSPFOP00000018016 XP_007560597.1.10163 XP_008436192.1.1237 XP_014866739.1.96476 XP_014903977.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]