SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018191 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018191
Domain Number 1 Region: 160-380,424-474
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-50
Family LacY-like proton/sugar symporter 0.047
Further Details:      
 
Domain Number 2 Region: 590-731
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.88e-18
Family Glycerol-3-phosphate transporter 0.027
Further Details:      
 
Domain Number 3 Region: 497-567
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000196
Family Pentapeptide repeats 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018191   Gene: ENSPFOG00000018083   Transcript: ENSPFOT00000018213
Sequence length 741
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519713.1:1861006:1883395:1 gene:ENSPFOG00000018083 transcript:ENSPFOT00000018213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STFSATMEDTYNNRTSLVKGAKDMVKEAKRHTAKKVNKVVDRAADEYSSHRNYTRFQDEE
DEDEDFYHHQKGHEGESCRDNEEGSSDATEGHDDEDEIYEGEYQGIPSSAADKKHKEGQV
ALGQPMSDAVRDRSELEQERDADEEELAQHYELIMQECGHGSFQWQLFFVLGLALMSDGV
EVFVVGFVLPSAETDMCIPNSSSGWLGSIVYLGMMVGAFFWGGMSDKVGRRHCLLICMST
NGFFAFLSSFVQGYGLFLLCRVVAGFGIGGAVPIVFSFFAEVLSREKRGEHLSWLCMFWM
IGEIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVCAVVALTFMPESPRYY
LEVGKHDEGWMILKQIHDTNMRARGQPEKVFTVNRIKIPRQLDELVEMESGTGNPVSKFF
FRIKAEIHGIYLNLMKCFKYPMQENTMRLAIVWFTLSFGYYGLSVWFPDVIKHLQADEYA
SKVQIHINERIEGFTFNFTLENQIHRNGTFIHDQFVNMKLKSVTFIDSTFRYCTFDDVTS
VGSLFKNCTFIDTFFFNTDIDESKLVEGTEVINSTFTHNKTGCQMTFVDDYSAYWVYFIN
FLGTLAVLPGNIVSALLMDKIGRLSMLGGSMILSGISCFFLWFGTSESMMIFMLCLYNGL
SISAWNSLDVVTTESFPTVRRGTGFGFCNALCKLAAVLGNLIFGSLVGITKAVPILMASS
VLVGGGLVGLRLPDTRSNVLM
Download sequence
Identical sequences A0A087YJI8
ENSPFOP00000018191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]