SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018690 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018690
Domain Number 1 Region: 181-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.2e-84
Family Protein kinases, catalytic subunit 0.000000625
Further Details:      
 
Domain Number 2 Region: 30-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.62e-26
Family Regulator of G-protein signaling, RGS 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018690   Gene: ENSPFOG00000018553   Transcript: ENSPFOT00000018712
Sequence length 591
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519901.1:301512:312887:1 gene:ENSPFOG00000018553 transcript:ENSPFOT00000018712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIDNMVQNSALVRAREGGGSKARSWRWKEMLRFPHISECRDLAKTISERDYYDLCVYQP
IGKKLFHLYCMTRQELHNYILLLDALEAFETKTDEERHSFGLYIINTFIRSQGNHCVPSL
TKHEQSYINSLEFDPCGDVFHKCKGFLHEYLSQEPFTQYQFSMHFDRFLQWKHLERRPIT
KNNFREYRLLGKGGFGEVWACQVRATGMMYACKKLEKTHIKKWQGEHMALNEKELLEEVD
SRFVVNLAYAYETKHNLCMVLTMMSGGDLRFHIHNMSKNGLAMDRVYFYAAEVCCGLIHL
HQKSIVYRDLKPENILLDDNGHIRISDLGLAVKLEDGDLVHGRVGTLYYMAPEVICKEEY
NTSPDWWGLGCLIYEMIAGKSPFRERGERPKSSEMEKRIKSKPVEYNEKFSKDAIDICNG
LLNRDPKHRLGCRGSGGKEVKSHPFFQQINFRMLEAGLVEPSFKPDPRLVYCDDVQDIEE
FSALRGVALNQSDGEFYAKFNTGSVPRSWQNELIDTGCFEELNIFGPMGSRPPDLDWSLA
PKSPKAKQGLFRRMFRRHHQLNTENKQSGKKTEANYHESRDFRFNARLHQK
Download sequence
Identical sequences ENSPFOP00000018690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]