SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000018967 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000018967
Domain Number 1 Region: 328-463
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-27
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 
Domain Number 2 Region: 101-161,273-330
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000222
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000018967   Gene: ENSPFOG00000018855   Transcript: ENSPFOT00000018989
Sequence length 614
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519624.1:945694:957369:1 gene:ENSPFOG00000018855 transcript:ENSPFOT00000018989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGSVQSAKPVMSFFKRKAKSKEPERVTDAKVNKVPVSPHSPSHGLKNHNAVLDAAGPSHM
AISAISANMDSFARGRTAILKKQPSHMEAAHFGDLGHSSVNYQPQETRSRMSKTVDQVLR
DNVAMPHFLHCMEQRGADHLVRFWLEAENFRSASWSRVRAQNLNSVKHSSLAEPVPVSPD
GPELDQNAFNDPALHNSRGNPSPLSTRRDSSSGEAKPSRADTPSRQAPSRTGTPSKGHPN
NTLQDFSDTLMKSESTEENLFNKSEPGEAKAIPHLITAMIMLEIFLRVCVTSSVTDVSAS
LVCPLISRHFTEFLRSHHFCKYQIEVLTSGSVFLADILFCESALFYFSEYMEKEEAMNIL
QFWLAADNFQNQLAAKKGQYDGQEAQNDAMILYDKYFSLQATNPLGFGDSVRMEIESNIC
REGGPLPDCFTTPLRQAWTTMEKVYLPGFLSSNIYYKYLSDLINSVRGDEFVNGKGQGQG
QGVPADGDRPGLNAGGESSQVQQGAKKAAIKILKNFDEAITVDVASLDPEMLYQRPYAGI
MTYFYIYTSPVLIFFCRFDMNLKFESTEAVKHACEQDGRRGKAQEEMAWKIAKMIVNDVV
HQSNHDSPGKSTKV
Download sequence
Identical sequences ENSPFOP00000018967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]