SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019099 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019099
Domain Number 1 Region: 53-139
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.69e-16
Family Linker histone H1/H5 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019099   Gene: ENSPFOG00000018991   Transcript: ENSPFOT00000019120
Sequence length 263
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519612.1:6813960:6815471:1 gene:ENSPFOG00000018991 transcript:ENSPFOT00000019120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIFCLLFTLQKTMPPKKQAADPQPSSNTAPAEELDEKKTSGLYTNARSVAARKPATHPST
AVMVREALKALDSRKGVSSQAIQNYIKQKYSTVEPVRLKHLVRRILKNGLLNGTLVRPVN
ATVTTGALGKFRLAPKVKEVKLKSENTDPNVQKPKAGAKKTQTEGNSKKKPTNEKAKSTK
NPKPPKATKDEVAAPSKVPPAKKPKAKKVEAKGSAAGSSEPTKNKTAKAKGAKTEKKTQS
KAVKSGSDAPASKTAGKRVKKAV
Download sequence
Identical sequences ENSPFOP00000019099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]