SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019216 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019216
Domain Number 1 Region: 214-309
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.76e-36
Family Forkhead DNA-binding domain 0.00000324
Further Details:      
 
Domain Number 2 Region: 18-91
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000684
Family FHA domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019216   Gene: ENSPFOG00000019094   Transcript: ENSPFOT00000019238
Sequence length 615
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519614.1:6599429:6609681:1 gene:ENSPFOG00000019094 transcript:ENSPFOT00000019238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVSGMLGSAIARLEGREFEYLMKKRSVTIGRNSSQGSVDVSMGHSSFISRRHLEIFTA
GEDGSGTREFYLRCLGKNGVFVDGVFQRRGAPPLQLPRMCCFRFPSTSIKITFTALSSDK
KEPRNVPESPVKPVQPQISPLTINIPDNIAHLMSPLPSPTGTISAANSCPSSPRGAGLSS
YRTSRVLTSEIIGDNSQSENDKEASGEDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNG
IYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVARSQEEPGKGSFWRIDPASEGKLI
EQAFRKRRPRGVPCFRTPVGPLSSRSAPASPNHMGVLSAHSSGVQTPDSLSREGSPVPME
AEAPPAAPTQTAAVQPKLAVIQEARFAQNSPGSPLNSQPVLIAVQRQMPQTTMKPVTYAM
ATPAMVTTPVSSAPVMQTVHVVHQIPAVTMATVGGQPASMESPEPQENGGGGGDRQEVKV
KVEPVPSITASSIGGVGRIIQSSQAAPLTTVTIVQQAPLGQHQLPIKAITQNGTHLVPIS
TAASSDSESLLCANPLHLLATHASASASLPTKRQNGELQDPPESKRAKTDEENGPATAIG
NNNGTTDSGGEADDK
Download sequence
Identical sequences ENSPFOP00000019216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]