SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019475 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019475
Domain Number 1 Region: 15-180
Classification Level Classification E-value
Superfamily EF-hand 1.11e-38
Family Calmodulin-like 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019475   Gene: ENSPFOG00000019360   Transcript: ENSPFOT00000019497
Sequence length 197
Comment pep:novel scaffold:PoeFor_5.1.2:KI519966.1:603553:605922:1 gene:ENSPFOG00000019360 transcript:ENSPFOT00000019497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLEMGQTQQTGSCEEIDVKALQDMYKKFVLECPSGVLFLHEFKRFFGVDPTGEASDYAEN
MFRAFDKNGDNTIDFLEFVAALNLVFRGDLEHKLRWSFKVYDKDGNGYVDRNELRSIIDS
IYRIKKFSKKDMSETQLSVDEVVERILDAVDFDGDGHITLEEFIRGAQEDPWVLNMLRLD
MNPAGWVLENRRKSAHF
Download sequence
Identical sequences ENSPFOP00000019475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]