SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019644 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019644
Domain Number 1 Region: 372-465
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-27
Family La domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000019644
Domain Number - Region: 839-939
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 0.0408
Family MPP-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019644   Gene: ENSPFOG00000019519   Transcript: ENSPFOT00000019667
Sequence length 1105
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520124.1:250257:291793:1 gene:ENSPFOG00000019519 transcript:ENSPFOT00000019667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEVECSQVDSGLTASSSNGVQDKNQNKSEGAHLHKEQEEPGQRGTEKQQADDHKQEST
KSQADTHKKSKENDKENEQSGNADSAVEAVKKKVVEAPPPKVNPWTKRTTGRVPVSNINS
GSQETDQQNALKVVRASKPRVRKPSKSSDFSDITNWPTPGELAKEQQQTVLGNNGKKPSS
RRERKSESSHDGGESKENQEAHVDPMEEPSKEGEPKPGQDSKSSSLKKRGGEGNKRKWVS
LPLEEVSRDDADKTSGGFPAQLDTSPISDSSNPTSPNQRVHDNRAHYDSRSWRAEPRDHG
DDTGSIRSDGGTGRGGIRGRGKGRGRGRGRGRGRYEYSLNYRDARSSDGSGQVPTEFGTN
MVYYYDDGSKVQMYTVDEKLLKEYIKRQIEYYFSSHNLERDFFLRRKMDAQGFLPISLIA
SFHRVQALTTDVNLIIEALKSSTEVELVDERIRCKTEPERWPIPTPPVVGSPRTDFSQLI
NCPEFVPRQNLNTVSAATLPVKEPLIGPAEPSSSNQDSLLAADNSKDGPASEPKPDPDAW
IQVEKRHRQTSGKSKPPPALQGEPKAPPAQSSQPPPQAELDQEELDFMFDEEMEQMAPRK
NKFTDWSDEDDSDYELDDQDVNKILIVTQTPPYLRKHPGGDRTGNHESRAKITADLAKAI
NDGLYYYEQDLWKGEEQIECSKCKQDVENFKKLNVISKDEFDTLTPKVPVDPNQEVPPPP
MTEGTTTSCNSKRINCLVRTVESGSDLARSLPTTVPESPSTSQPRTPRTPRTPGRQDPNK
TPRFYPVMKESGAIDGQMPRKKKTRHSSNPPQEAHIGWVMDSREHRPRSASIRRVHSSSN
ASPSEGAPLTGSYGCTPQSLPKFWHPSHELLRDNGFTQQGYHKYRRRCLNERKRLGVGQS
QEMNTLFRFWSFFLRDNFNRKMYEEFKQFALEDAKENYRYGLECLFRYYSYGLEKRFRLD
LFKDFQEETLKDFEKGQLYGLEKFWAFLKYSRIKNQPIDPKLQEHLSKFRNLEDFRVVPP
IGEEGGRRRYPSSSAGDEGRRRRHPSNSTSKPVQASKSANVPPQPTAALTSASTQSSAKD
STQKATAPSNPGKKAAKKDGVSPNK
Download sequence
Identical sequences ENSPFOP00000019644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]