SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000019979 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000019979
Domain Number 1 Region: 958-1087
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-47
Family Regulator of G-protein signaling, RGS 0.00000573
Further Details:      
 
Domain Number 2 Region: 191-276
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-19
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 34-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.21e-19
Family Synaptotagmin-like (S variant) 0.0023
Further Details:      
 
Domain Number 4 Region: 454-560
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000738
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000019979   Gene: ENSPFOG00000019852   Transcript: ENSPFOT00000020002
Sequence length 1099
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519616.1:5342518:5474909:1 gene:ENSPFOG00000019852 transcript:ENSPFOT00000020002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVHLSPGIYIAPKQEVVVSTIFIKLIYSSLFFIGQLKLSVFKEREILVVSVLEARDMLSD
FQESCNSYVKVGKFPDSDPKGRQKTPMVPQCRNPIFLQTFYFTVSEEDLHKRLLFTVWNA
DSASSINRASVLLGCMSFGLRSLMDADKETQGWYYLLGEELGRWKHLKVPESKIRDIDDT
LLAVPGGGPTRHTKSLQVTILRGKDGYGFTICSDSPVRVQAVDPGGPADQAGLQQLDTLL
QLNGQPVEQWKCVDLAHAIRNSANEITVVVWRTGPSAKPSFEGLIHRPSYKPSTSNYDAP
SPPTRRRAPDVGPSKAPPAVPPLPAHHRPTAARRLLVNGSETGNGVGGSRGTLAWGAGTR
VKASNGDNYIILAPINPGSQILRPVYTDNQGTLGSNNSKASKGSSTSPTVGLANYQQQNA
NFANYQNCTIVRSHTPHANYGYVKVAPKILIFPIFVQPLDLCSRTLIISEEMILHESKHH
SLKVTVFVYNDLLLITRENEPGRCNVLQSPLYLRHLRLQDDYTDGMRFYLIHMTEKCDCL
LSLEAYSADQKRRVCQCLKDNIDKQLQLHRREPSVPHFEQRIKERRKKVLLERSLPNSMD
KLLSVSVSLVEKCPKAHQMSPNSSNGKLPARKHSISDMRSSVTEKNSPPPPSSKGSASNL
RHQIPPILPAKKILPLQRVPHRSEITKHFDRILRKRIERRKQSTAEQQPFSFCLDKPGSI
SLSLPVKTLSTDEDNVSEPPDTNAPPSSSSSSFVIPELRLDRSFSADALSSPNTDEEEYD
EDEEEESEEDDEDDSDDAYLQRTDSKRRSMVEGATCEKHGGGRLSVQNSLRRRTHSEGSL
LQEPRTPCFTSDNAINCLEAGGVHPKGGWTLPSPKTLKKELMKNGGSMHQLCMLFSGRKV
SKAHTVSCEVSPNGTKKKKSKNLAKDMKNRLAFLRRRNESPGSNPAGKLDKSMKSVKPTP
EEALKWGDSLDKLLAHKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMASKAKK
IFAEYIAIQSCKEVNLDSYTRDHTKDNLQNVTRSCFDLAQRRIYGLMEKDSYPRFLRSEL
YLDLINQKKPSATSTSSSS
Download sequence
Identical sequences ENSPFOP00000019979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]