SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020224 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020224
Domain Number 1 Region: 359-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-65
Family SPRY domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-22
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 141-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.18e-17
Family B-box zinc-binding domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020224   Gene: ENSPFOG00000020098   Transcript: ENSPFOT00000020248
Sequence length 547
Comment pep:novel scaffold:PoeFor_5.1.2:KI520327.1:73011:74651:1 gene:ENSPFOG00000020098 transcript:ENSPFOT00000020248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGSSLRSEDQFLCSICLDVFTDPVSTPCGHNFCKTCITQHWDGDALSKCPLCNEPFTP
KPELKINTFIKEMVDQFRLKAQQEASSSSEQQAAKPGEVPCDVCTGPKLKALKSCMVCLT
SYCQTHLEPHLTAPRLKKHQLMEPVENLEDRMCLQHDKPLELFCRTDQTCVCLVCSVFDH
KNHELVPLREESEGKKAELRKTEAEVQEMIQERRLKIQEIRESVKISRDAADREKAEGVQ
VFTALMESAERGLKELLKEIQDKQETTEKQAEDFIRDLEQEISELKKRSSEVKQLSQDED
PLHLLQSCSSLKAAPPTKTWTEVRVHPPYYEGTVVKAVVHLEETIREKKMKKLLEVELKS
VQQFAMDVTLDPDTAHLDLILSDDGKQVRDGDVRKKLPDNPERFSLFSNVLGQQSFSSGR
FYFEVQVKGKTDWTLGVARESVDRKGDISLCPQNGFWTVGLRNENSYKAAAGPSVWLFLH
PGPQKVGVFVDYDQGLVSFYDVDAAALIYSFTDCCFKEKLYPFFSPGLSDGGKNSAPLII
CPVLHTS
Download sequence
Identical sequences ENSPFOP00000020224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]