SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020752 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020752
Domain Number 1 Region: 372-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-51
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-20
Family RING finger domain, C3HC4 0.0062
Further Details:      
 
Domain Number 3 Region: 137-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.27e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020752   Gene: ENSPFOG00000020627   Transcript: ENSPFOT00000020777
Sequence length 549
Comment pep:novel scaffold:PoeFor_5.1.2:KI520263.1:185828:187474:-1 gene:ENSPFOG00000020627 transcript:ENSPFOT00000020777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKMEENQLDHETLSCSICLDVLKNPVTIPCGHSYCMNCIKSHWEREDQKGIYSCPQCRET
FTPRPVLKKNTVFAALVEQLKKTGLQAAPAGPEDVACDFCTGRKLKAIKSCLFCLASYCE
KHLQPHYDVAPLKKHKLVEPSKNLQENICSKHNEVKKMFCRTDQKCICSLCLMDEHKGHD
TVSAAAERAERQIELEVRREKIQQRIQDREKDVKLLQQEVEAINHSADKTVEDSEKIFTE
LIRLLQKRSSDVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTEDHSQF
LLNYPSLPAPSESTHSSSIKVRRLRHFEDVTAAVSELREELQDVLRETWKQSSLTLTEVD
VLLSETEPVSRDGYLKYSCEITLDPNTAHKWLVLSRENRKVTRKAQHQSYSSHPDRFTHW
RQVLSRESLTGRCYWEVEKKGRVYVAVAYKNISRAGSGNECLFGGNEESWALDCHQNRYK
FGHNNIWTSISGPVSSRVGVYLDHRAGTLSFYSVSESMTLIHRVQTTFTQPLLAGIWVGF
ACHVEFCEP
Download sequence
Identical sequences A0A087YRU9
ENSPFOP00000020752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]