SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000020997 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000020997
Domain Number 1 Region: 92-184
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-39
Family Forkhead DNA-binding domain 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000020997   Gene: ENSPFOG00000020875   Transcript: ENSPFOT00000021025
Sequence length 392
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520002.1:212342:213517:-1 gene:ENSPFOG00000020875 transcript:ENSPFOT00000021025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLKTPERLFHKSSFSISSLLWRREGMVDDQDSPSSRPLHSEKTCQEENFDSDKSCENS
KLSAKKDIKPPKREENKREAKKTGEEERVKPEKPPFSYNALIMMAIRQSPERRLTLNGIY
EFIMNNFPYYRQNRQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPCSDDVFIGG
TSGKLRRRATVSSRSKLGLKRGGGGRLMPPNTAASVTLAAASSFYWPVPPFLPLQAPVRA
HVGAGTYQRGQPRLSNHAASVVSHQTRLSATSTADADRFVRTRQEMSYIGVSCAQSRRHQ
IGSACASFSATSIPACTLPLSDPCSFNMISGQASYFYSHQIPCAAAFSPCPEECGASKTG
QLLSKSGHSELGGYCTDFPNYCPQVSPSPSFG
Download sequence
Identical sequences ENSPFOP00000020997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]