SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000021069 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000021069
Domain Number 1 Region: 69-164
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.44e-39
Family Forkhead DNA-binding domain 0.00000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000021069   Gene: ENSPFOG00000020947   Transcript: ENSPFOT00000021097
Sequence length 320
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519724.1:1619303:1620265:-1 gene:ENSPFOG00000020947 transcript:ENSPFOT00000021097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGLEGFVDMEDIVIDVVGEGLKDGGEEQLSLSEESRSEPERSAETSSSQTEDPACPPP
AKTKSPASVKPPYSYIALITMAILQSPKKRLTLSEICDFISHRFVYYREKFPAWQNSIRH
NLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGSFLRRRKRFKRQHFRFDPLKEQH
LEPRGLHCFTHGGYGLGAAALQLPGLEIYPFLHHHHTPSPCGTAAIPPVSSILPALSTFF
SRSALTAKAFLQSQPGLDAFSPAQCAAYSPPLTSGAHYAAPGLFRPAASPQLLGLHQEYQ
KLQTQLSGADLAKHINANNE
Download sequence
Identical sequences A0A087YSR6
XP_007560391.1.10163 ENSPFOP00000021069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]