SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000033 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000033
Domain Number 1 Region: 441-607
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-46
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 136-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-16
Family B-box zinc-binding domain 0.00054
Further Details:      
 
Domain Number 3 Region: 7-76
Classification Level Classification E-value
Superfamily RING/U-box 8.16e-16
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000000033
Domain Number - Region: 203-272
Classification Level Classification E-value
Superfamily BAG domain 0.051
Family BAG domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000033   Gene: ENSPFOG00000000037   Transcript: ENSPFOT00000000033
Sequence length 615
Comment pep:novel scaffold:PoeFor_5.1.2:KI520125.1:6014:18907:-1 gene:ENSPFOG00000000037 transcript:ENSPFOT00000000033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPDRLKFCCSICLDLLRVPVTIPCGHSYCMNCIKTHWDGEDQKGIHSCSQCRKTFVPWPV
LEKNIMLADLIEELKKTGLQAAAADHRYAGPEDVACDFCTGRKLKAIKSCLFCLASFCEK
HLQPHHDSAAFKKHKLVEPSKNLQENICSKHDEVMKMFCRTDQKCICYLCSVDEHKGHET
VSAAAERTERQRELEERRGNIQQRIQDREKDVKLLQQEVEAINLSADKAVEDSEKIITKL
IRLLRKRSSDVKQQIRSQQETEVSRVKNYFNIFISYSDCVQQVLSSLLFRESSISFCFSK
LQWLSVGCPQGNTLTLEFSACGRAQHATFKNCGFKLSDDLMKIEQSLSHLNKLEIQTQQL
LLSEGNRKVTLIRLPPSYCSHPDRLLQVFPVHYIMILVCASFSCRQKAELLDFSPWVNTI
MTFDNIQTLIPEPEPKSRAGFLKYACEITLDPNTAQTQLALSEGNRKVTWMKQPFSHPDR
FTHYFQVLSRESLTGRCYWEVEWSGGPTFIGVAYKNICRVGSGKKCGFGYTDKSWALNCS
QDGYKFGHNNDWTSVSGPVSSRVGVYLDHRAGILSFYSVSESMTLIHRVQTRFTQPLLAG
VYIYITGDSAEICKL
Download sequence
Identical sequences ENSPFOP00000000033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]