SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000186 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000186
Domain Number 1 Region: 197-454
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.07e-49
Family Mitochondrial carrier 0.00078
Further Details:      
 
Domain Number 2 Region: 18-185
Classification Level Classification E-value
Superfamily EF-hand 1.39e-33
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000186   Gene: ENSPFOG00000000196   Transcript: ENSPFOT00000000187
Sequence length 467
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519818.1:246820:252905:1 gene:ENSPFOG00000000196 transcript:ENSPFOT00000000187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMHRRQHTGQTTVQIFKSNMDRFRGLFVKLDQNKDGFISMAELHEEMRKHGIISGDGKV
QHIMESYDKDKDGLLDYKEFLSYMMDREKKWKIHFHDLDKNNCGVIDQEDIMCLFKELGV
VISKPNAKTIIQMMDKDKSMTVDWDEFLHYIILNPVDNIGELVSSWKHSLVFDVGESRAM
PIEFPDNVSGFGAWKTFVLSAGLADAVSRTATAPIDRLKTQLQVLGSKAFSQGFQELRGG
GLRSMWQGNVVNVLKGTPQSTLQCLIYAQMKVYTQNRSREPLTVQQRFGLGCVSGAVAHA
AFYPLEVLKVRLNLQQAGTYHGVVACARSIYKHESMSSFYRGFRPSILCMIPYAGVECAV
HQSIMSWAKSDPTYSSDSKLFFFSFVAFASGQISSYPLAVIRTQQQAQAFISDSRPASGM
LSGLTGIYERNGFRGYYNGMGASFVRAIPCVLINYSLTKKFENVFSS
Download sequence
Identical sequences ENSPFOP00000000186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]