SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000325 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000325
Domain Number 1 Region: 418-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-67
Family SPRY domain 0.00000931
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 6.86e-20
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 3 Region: 188-248
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000488
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000325   Gene: ENSPFOG00000000268   Transcript: ENSPFOT00000000326
Sequence length 603
Comment pep:novel scaffold:PoeFor_5.1.2:KI520109.1:203322:216831:1 gene:ENSPFOG00000000268 transcript:ENSPFOT00000000326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNGSFLTEEQFTCSICLDVFTNPSSIPCGHTFCMACITRYWDGSQVCQCPLCKKTFQK
RPDIQINRTLREITDQFKSMKGGGSVKDKKGKMMGHKNHNFMAELKMKLPKPLAKDVAAL
TGTTQSQGLSTSTLHPTGTTTMALSVPNHRGSSSLNHSPENQHLNHHHFPHMMSYSNSRR
RFTLSGAASSKNIPLCEIHNRGILLYCKSDQVCICPECEIEDHNDHDTVTVEAEWMETKM
LLRDSEQDIQDMISERRRKMEQIRESVTELEMAVERETSGTVCLFSALASAIERSQAELI
EVMDNSRRSAEHQADAMIHQLEKEIEELQRREAALAELAQSEDHVHCVKTFPSLSTPPVT
KNWTGVSLNTDLGTAAIYRSLAATVEKFQRDLRNILEHGFPSPILEASLAQTKPRERKMQ
DFALNVTLDSNTAHPRLVLSEDLKSVWCGDRHHHVPDTPERFDRVVCVLGREAISHGKHY
WEVEVNGKTDWDLGVARQSVNRKGKIDYTPNNGFWFLSLRDKHKYAFRSEPCTDVEMNLR
PHKIGIFVDYEKGEVSFYNVDAKVHIYTFHDIFTENLFPFFSPCTNKSGKNEMPLIITPV
QME
Download sequence
Identical sequences ENSPFOP00000000325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]