SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000371 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000371
Domain Number 1 Region: 172-243
Classification Level Classification E-value
Superfamily Homeodomain-like 2.52e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 31-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000026
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000396
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000000371
Domain Number - Region: 95-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0333
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000371   Gene: ENSPFOG00000000403   Transcript: ENSPFOT00000000372
Sequence length 400
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519879.1:20199:50020:-1 gene:ENSPFOG00000000403 transcript:ENSPFOT00000000372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVLCAGCERPILDRFLLNVLDRAWHAKCVQCCECNCNLTEKCFSRDGKLYCKMDFFSVS
RRFGTKCAGCLQGISPNDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKE
DYLSSGAIKEVNLNSAVSSCTDRSLSPDLQDPIQDDIKETDNSTSSDKETNNIENEEQNS
GAKRRGPRTTIKAKQLETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKER
RMKQLSALGARRHAFFRGPRRMRPLGGRLEDPDILGPGPYGYYGEYQGDYYGPGSNYDFF
PHGPPSSQAQSPAESPYILGSGPGAIEGSGHHPSDDQRYTDMISHAETPSPEPGLPSSLQ
PVPGDAYGGGPSPPFSLASNSSYSAPMSHQGQEMGETGAW
Download sequence
Identical sequences ENSPFOP00000000371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]