SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000550 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000550
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000383
Further Details:      
 
Domain Number 2 Region: 216-314
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.42e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 425-484
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000471
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000550   Gene: ENSPFOG00000000587   Transcript: ENSPFOT00000000551
Sequence length 497
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519667.1:220301:229682:1 gene:ENSPFOG00000000587 transcript:ENSPFOT00000000551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGKNKTESVPSSLLSQQENEKLEELLGRRCASMATAVAQLFMALPNSPSMWSLQHTGV
VCFVKDNPQRSYFIRMFDLKVGRQIWEQELYNQLVYSTPLPYFHTFAADDCQVGLNFTDQ
QEADAFQGTIMEKINQRHNRQATEKKQRPPPKNDLGNSVSFHMATVDIQNPDIQSSRYRS
MPSPAIPPAVSSKGKKNKKDKKKAGKISKADIGAPSGFKHVTHVGWDPNNLDPDLSKLLS
QAGISVSDLKDEQTSQMIYNVIEQSGGLEAVKREMNRGDVPPPPPSSRQGPLPPVPGPGP
PAPPPSRGRSGPLPPIPGQAQRGAPPPQPPPSRGGLPPPPPTSRGGPPPPPPPAHSSLPP
PPPSSRGSHSMPPPPPPSSQHRSMGVPPPPVPSTPSSAPSDFPPPPKIGGAPPPPPPASS
GGGDGRGALLDQIRLGKSLRKVTESSEPPPPSTPEGGEGIVGALMMVMQKRSKVIHSSDE
SEEEAGYDDDDDDEWDD
Download sequence
Identical sequences ENSPFOP00000000550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]