SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000647 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000647
Domain Number 1 Region: 105-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 838-904
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000203
Family SAM (sterile alpha motif) domain 0.0084
Further Details:      
 
Domain Number 3 Region: 262-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000267
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000647   Gene: ENSPFOG00000000640   Transcript: ENSPFOT00000000648
Sequence length 943
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519636.1:241991:255632:-1 gene:ENSPFOG00000000640 transcript:ENSPFOT00000000648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLELDSTGETDPREQKDDEEEEKEVQSFTGDDTKRQCLDPEWVEERFRIDRKKLETMLYA
PEQGGETGEKFFERVMRETSTQVKWPSKLKIGAKSKKDPHVKVEGKRTDVTEAKKKILEV
LETKVNKVTLKMDVAFTEHSHVIGKGGGNIKRVMEVTCCHIHFPDSNRHNAAGEKSNQVS
IAGPIEGVEAARRRIRDLQPLSLTFDLPVSLVPQALPDAGSPLIQQVAQTLGVSVGFRAV
LPLPQAQTAFYGSSCTVWGLQGNAAAVKKATCILMELLLGSEASGGIVSSQLDVTAQQHL
FLLGQNGANFLSVMHKTQTQIILPDLSAPQSPPSLLIQGSPDGVCLARQQLMDCLPVCLM
FDIREDGEGGPSKVAQMIQNLGVFISVKPKAKQTGKSVVVKGLERNISCIYEARRLLLGL
DSSETAKITTVNPDLMSPGGRLANYWLDMLLQQLALSEQGSAPVQTTEVLTGTKSHLSAP
PGLTSPTDEGKTGPKGTESRQLEKILESENQSDQSEEESIEVVRMSPSEVRKAGNNNNIS
RVGVNGRRGSLQGPEISKTHSQGRRHSTGQALTYRWRKIQNSTVHNFVLVNHKESHPRAQ
NVHADSSKAGPCGTEDEREETSYAYRRCLFPSTPVCNLSQMLQCSKLTSVPPQQQEVSCQ
CLFLQQIRFLLSILSKQRGKINFMDYLPILFADYDYEKKKLMATRAMQRKPVVTEVRTPT
DTWSGLGFSKSMPAEAIKDLRSISRRSYKSYLSPNTNQQQSWATEKGKMCLGSDSENWRD
RRGSASQIVSSSSPSSSSPSSPSTPPPGFPSFCENSAGGCFFEGAYSARRESTCSQRSPS
PLVTDDLPELLSELGLIKYIDLFEQQEIDYQTFLTLSDEDLKEIGISTFGARRKMMLAIS
DLNKSKTSLSDAQPVKPGYLEGGASGRLPRILDLDVAVHSNRW
Download sequence
Identical sequences ENSPFOP00000000647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]