SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000823 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000823
Domain Number 1 Region: 315-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-63
Family Nuclear receptor ligand-binding domain 0.0000000541
Further Details:      
 
Domain Number 2 Region: 177-258
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-26
Family Nuclear receptor 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000823   Gene: ENSPFOG00000000801   Transcript: ENSPFOT00000000825
Sequence length 667
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520264.1:96227:176402:1 gene:ENSPFOG00000000801 transcript:ENSPFOT00000000825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPGLSPDPLPMLQLHDGDYSKASERPTSPGLLPTMYSPPMGIEGHTVCIPSPYTDSR
HDYHGHLPLTFYSPSVLSYSRAPIADSPSSMCPPLSPSAFWPSHNHHSIPSLTLHCTQPL
VYNEPNPQGPWLESKSHGMNPNSSVISCNKLQRKKSEEAGEEIKSSSCSSAVGKADMHFC
AVCHDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKC
YEVGMMKCGVRRERCSYRGARHRRSGLHLRDATGRSLVRVGMAPRIQRLPPMELSLPPLV
QPSQSNQPFMSPEEFISRIMEAEPPEIYLMEDLKKPFTQASMMMSLTNLADKELVLMISW
AKKIPGFVELSLADQIHLLKCCWLEILMLGLMWRSVDHPGKLIFSPDFKLSREEGQCVEG
IMEIFDMLLAATSRFRELKLQREEYVCLKAMILLNSILCNDNCSTAAGLPKKNKLCKNLD
SVIDALVWAISKLGLSTQQQTLRLGHLTMLLSHIRHVSNKGMDHLSTMKKKNVVLVYNLL
LEMLDANTSSSSSQTAASSPTSETYCNPIPPPFYLQAVLDQTFTTSPSTDICMVPPEEPV
QDHMMVRHMQSQGLLSSSPIGSQMKSEDYTAPEHWSMDGRDASSSGEPPGYIIADQVVME
TTLEDNL
Download sequence
Identical sequences A0A087X4X0
ENSPFOP00000000823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]