SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000000950 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000000950
Domain Number 1 Region: 382-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-36
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily RING/U-box 5.74e-21
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 142-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-16
Family B-box zinc-binding domain 0.00057
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000000950
Domain Number - Region: 194-301
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00445
Family HBL-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000000950   Gene: ENSPFOG00000001003   Transcript: ENSPFOT00000000952
Sequence length 559
Comment pep:novel scaffold:PoeFor_5.1.2:KI520745.1:5825:9330:-1 gene:ENSPFOG00000001003 transcript:ENSPFOT00000000952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQQAVQLDRETFSCSICLDLLKDPVTIPCGHSYCMDCIKAHWDEEDQNRVHSCPQCRKT
FTQRPVLQKNTMLAALAEQLKKTGLQAGPADHCYAGPEDVACDVCSGRKLKAIKSCLACL
ASYCEKHLQPHYDSAPLKKHKLVEPTKNLQENICSKHDEVMKMFCQTDRKCICYLCPVDD
HKGHNTVSAAAERTERQRELEERRGKIQQMIKDKDKDVKLLQQEVEAINHSADKTVEDSE
KIFIELIRLLQKRSSEVKQQIRSQQETEETEVSRVKDVQEKLEQEISELKRKDAELEQLS
NIEDHTQFLHKYPSLPALSESTHSSIINIRPLRHFEDVTAAVSELREKLQDVLKDPWTNI
ELSFTEVDVLLSEPGPKSRAGFLKYSCEIILDSNTADKQLVLTDENRRVTRINQSQSYSG
NNDSGSFTGCCQFLSRESLPERCYWEVELGGQQVCVAVAYKNISRAGNDYDKSWALLCYC
GSYNNNNFTFVHNKIQTYISSPRSSRVGVFLDHRAGLLSFYSVSETMTLLHRVQTRFTEP
LHAGVWIKKTGDFAVFCKP
Download sequence
Identical sequences ENSPFOP00000000950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]