SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001008 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001008
Domain Number 1 Region: 389-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-37
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 18-91
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-20
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 153-218
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000717
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000001008
Domain Number - Region: 205-294
Classification Level Classification E-value
Superfamily OmpH-like 0.011
Family OmpH-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001008   Gene: ENSPFOG00000001052   Transcript: ENSPFOT00000001010
Sequence length 569
Comment pep:novel scaffold:PoeFor_5.1.2:KI519740.1:55098:64021:-1 gene:ENSPFOG00000001052 transcript:ENSPFOT00000001010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKEEDLQDNQCGVNLDREQFCCSVCLDLLKEPVTIPCGHSYCRSCIESCWDRQGEREE
YGCPQCRETFHPRPVLKRNNMLAEVVKNLKMMRYPQPPPPSLTLPAPPDVACDFCSLGRN
KATKSCLTCLASYCDKHVEPHYTVPVLQKHELISATMPVGDKVCTEHRKLMDLCCQTDEQ
LICTECTVDKHKGHTFVSILELKETTKERLEKVRKQVQEKVQQREEELETIIQAEKNVKS
SAQISKADCAKAFSELISSVQNRRSKLEQLIEAQEKSALAQAGELKQRLEKELGELRGRD
AQLLRLSSSDDVVYLAQNLGFLYDSRNSISVAFQDFAPGAGPPRSFTDVTACVTELKAKA
DILLNETWPKISATVSYVDFSLPPAPNSREEFLRYWRPLTLDDTSNYPNLNLVDSCKMRP
SPIPYPPHPNRFTKFPQVLCKEALTERSYWEVEWHARTLSVAVAYADANRTSDESEFGRN
DKSWTLECSGDTLKFRHNDVDMKVPGSCSKKIGVFLDYQAGILSFYQVSDQMLQIFEVQT
MFTEPLHPGIGLNYEWYDTGVFAQLAILK
Download sequence
Identical sequences ENSPFOP00000001008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]