SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001180 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001180
Domain Number 1 Region: 385-555
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-37
Family SPRY domain 0.0038
Further Details:      
 
Domain Number 2 Region: 12-87
Classification Level Classification E-value
Superfamily RING/U-box 4.37e-21
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 151-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000534
Family B-box zinc-binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001180   Gene: ENSPFOG00000001154   Transcript: ENSPFOT00000001183
Sequence length 564
Comment pep:novel scaffold:PoeFor_5.1.2:KI519740.1:74908:79654:-1 gene:ENSPFOG00000001154 transcript:ENSPFOT00000001183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENPPEHGVDLDQSQFCCSVCLDLFREPVTVPCGHSYCRRCIETCWQRDEEAEGRYSCP
QCREVFQPRPVLRKNITLAEVVGKLKVMGTMETPLFVEFTCAGPDDVACDFCCESRRHKA
SMSCLTCLASYCSFHLASHYTVPALETHQLVSVTVPLKEKMCKKHKKLLEVYCQSDKRCI
CYLCIIDEHRGHFTVPASAERATEQILLNMHQIGVQRSLQNRENELRELGKALEDFKVCS
RTAVDNVDKTINMLISSIQMRRILAKQMMDMREKLAIAEAEKLQLQLQEEITKLRKRNGD
LQKLSLSSDHIHFIQTFPALSTSCESPDLPPGAVVRPRESMAAASRFLDDLKDKVDGILE
DSWSNFSATAVSAVNVVLPPVPKTREQFLLYGCVLTLDIQTAHKCLSISKEQQRDVSVSR
YTPYYVSRSDMFESVKQVLCCEALSERCYWEVTWEGSFCAVAVAYKDIARSSSDSEFGCN
DKSWSLECSKDSYVFRHRSQKKVLSGPLTSWIGVYLDYRSGTLAFYSISKEMMLLHREQT
MFCKPLYPGLGLKDDVQAKLVKLW
Download sequence
Identical sequences A0A087X5X7
ENSPFOP00000001180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]