SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001297 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001297
Domain Number 1 Region: 604-712
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-26
Family SPRY domain 0.0021
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-19
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 152-215
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001297   Gene: ENSPFOG00000001286   Transcript: ENSPFOT00000001300
Sequence length 751
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520061.1:219862:230667:1 gene:ENSPFOG00000001286 transcript:ENSPFOT00000001300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKLWTEEQFNCPVCLDLPNDPVTIPCGHSYCMACIRDFWSKDDPKGIYSCPQCRQTFC
PKPPLSRNTMLAEAVEQLRKGALTSEVRDSIRSARGLSSRSKSRLSTGAVLCDMCKGEQR
AAVKSCLACMSSFCETHLKPHQTKKSLKQHELIPPTSNLAEKICTQHKYLQEFFCRQCKM
FVCWLCTSNQHKDHECVSTKAERQERQKLLSDIQADNQQKLKRREQELKDMKKMMEGVKR
SADRVHDETENIMGELLRSVERLQELLEEVLDQASLGKMNQAQEVADNLEAEIRERRKRD
TEMKDLADCADNIYYLQTCDTMSSPLECGDLPAVQVNHSATFEPIREAVLALRDRVEDLC
NQELGKINKQVNETKLFTLGNSSRLGGKKGIRDLFSGLSKNTDNRTPTSTITLDVRSTDR
QGPALRGADVRSRDAPRDRGSTNSPRMGNRQRREEREAEKRESNPSPTPSRRGGPSLWSR
SSQNPVAPPAAMTPTPIPATPTPTPVPAPSPAPASSGAFSRMASITSLFRSHRRGANQAT
PVNNIAAAGGNPGGMADLLETPTEINPGLFLDTPLPNAMTQAPAFPALREINLDTIQAPE
PRSREEFLQYSVILTLDPYTAHKRLVLSEGNTKATLQGPTQPYADTPQRFDGWTQVMCQS
PLQAQRSYWEVEWRGRGSSVGVAYGSLSRKGNDARSGLGYNAQSWTLELSDTARPCTPTR
RGTSPSPTRPAWASTPTCRRGCCRSTAWRTT
Download sequence
Identical sequences ENSPFOP00000001297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]