SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001595 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001595
Domain Number 1 Region: 121-132,286-531
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-60
Family Nuclear receptor ligand-binding domain 0.00000036
Further Details:      
 
Domain Number 2 Region: 49-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.38e-28
Family Nuclear receptor 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001595   Gene: ENSPFOG00000001645   Transcript: ENSPFOT00000001598
Sequence length 534
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519725.1:79073:82311:-1 gene:ENSPFOG00000001645 transcript:ENSPFOT00000001598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIPGYYAQQPQPPAHFSGSHPEDLLTQEGSSTSREQKTEADSRSESEESCPVCGDKVSG
YHYGLLTCESCKGFFKRSVQNNKHYTCSEQQRCPMNRSQRKRCPFCRFQKCLAVGMKKEA
VRADRMRGGRNKFGPLYRRDRQMKQQKANTDPYRIKMETRQTPGPQSPNDHRISGSTSNT
SSSAAFHLSHIMYPSGMEQSCQPMPLDCTMNNHRVLSPPSVPFRGLCCGFPEYLQDKGEP
SFSYNPVPTHFSAHSFTPTCTPTSSPCSTPSSAPAISQAGTQTTPPPTTPSPSFLIQLLE
GEQDEGQLCTKVLASLQREQANRGKHDCLNTFSIMCKIADQTLFGLVEWARNSNLFKELK
VDDQMSLLQSCWSELLVLDHLCRQVTYGKEGCIYLVTGQQIEVSTIMSQAGTTLSSLVSR
TQDLVFKLKALQFDRHEFVCLKYLVLFNPDASDVKSVQNRRQVEQTQERVNRALMEHTQQ
SHPGHSDKFGQLLLRLPEVRSISLQVEDYLYQRHLLGDLPCNSLLAEMLHAKHN
Download sequence
Identical sequences A0A087X742
ENSPFOP00000001595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]