SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001603 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001603
Domain Number 1 Region: 136-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.45e-85
Family Nuclear receptor ligand-binding domain 0.0000000184
Further Details:      
 
Domain Number 2 Region: 29-116
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-29
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001603   Gene: ENSPFOG00000001655   Transcript: ENSPFOT00000001606
Sequence length 438
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519672.1:360598:372151:-1 gene:ENSPFOG00000001655 transcript:ENSPFOT00000001606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFAAFCLVMEPTVVSTSTVAPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSM
KRKASFTCPFNGSCTITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKKDLIQRRKE
EEAQREAEKEARRPRLTDEQSHVIATLVEAHHKTYDDSYSDFCRFRPPVREGPVTRSASR
AASLHSFSDASSDSFSHSPESVDTKMNFNNLLLMYQEHGNSPDSSEEEGSSFSMLPHLAD
LVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFNLEDMSWSCGGPD
FKYQISDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPGSSDADRPGVQ
DHTRIEALQDKLSETLQAYIRLHHPGGQLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPE
HSMQLTPLVLEVFGSEVS
Download sequence
Identical sequences ENSPFOP00000001603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]