SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001690 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001690
Domain Number 1 Region: 45-148
Classification Level Classification E-value
Superfamily ISP domain 0.00000000000354
Family Rieske iron-sulfur protein (ISP) 0.051
Further Details:      
 
Domain Number 2 Region: 163-238
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.0000000103
Family Hypothetical protein TM0207 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001690   Gene: ENSPFOG00000001698   Transcript: ENSPFOT00000001693
Sequence length 589
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519619.1:22792:55935:-1 gene:ENSPFOG00000001698 transcript:ENSPFOT00000001693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQNKHDKKCKCSSTAIKRESRSKITIGKMEAQTSKVVLSLNAKEVDSLKDGVSFKKNPED
GRCYIIYKSSGGFKACKNQCKHQGGLFIKDIEDLDGRTVKCTKHNWKLNVSSMKYVNPPD
SFLQDELEVEMLDDGGMQLVELSPIDPWLTDPRDPLELQEGEVKITYLTHACMELQLGQK
RFLFDPWLKGPAFARAWWLLHEPPADCLDRLCAADLIYISHLHSDHLSQNHVKQLKSSKQ
SSPISFVWVCLAQTQNFKNIYCCDLQIGQIKVFHVRRHVESNISHVKLRSEKYSSYICIR
PLFFSQSPSDFTFQGFPVQYKPGGPPGFTCPPTRLSIAYFCKVFLRCLHFLRRYSWCSAH
NYQVIFSNFLSTLNIQLKNTTGCWINVCPRAQSPGLETLYLVKIVRNVDNEAITDPPANA
KIYKDSWEFDLYVDELNSAISSEIFKHESWIQFYYSWAGFQNYNLVVRMIETDDSFKPMS
NGYDYLVDFLDLSFPSTRPDREHSYIEIKNRIGVMRYVVLHGGLWDDLYIGFQNRISRDP
DTYHHKFWNHFQTQLPLHGPDWDQFLQQVPPIQETDALNYGLLNYCSIL
Download sequence
Identical sequences ENSPFOP00000001690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]