SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001906 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001906
Domain Number 1 Region: 721-945
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-57
Family DBL homology domain (DH-domain) 0.000000222
Further Details:      
 
Domain Number 2 Region: 323-503
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.52e-44
Family Regulator of G-protein signaling, RGS 0.00000174
Further Details:      
 
Domain Number 3 Region: 945-1075
Classification Level Classification E-value
Superfamily PH domain-like 3.92e-28
Family Pleckstrin-homology domain (PH domain) 0.0000467
Further Details:      
 
Domain Number 4 Region: 38-126
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-21
Family PDZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001906   Gene: ENSPFOG00000001737   Transcript: ENSPFOT00000001910
Sequence length 1400
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519740.1:167275:191599:1 gene:ENSPFOG00000001737 transcript:ENSPFOT00000001910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLRQPTSTLDRLNSLTAGDSERRAPASQQREVTIDESSSKPGPGLVHRCVVVQKDQLGF
GFTVCGERVKLVQNVRPGGAAVKAGVHEGDRIIKVNGSSVSTMTHQEVVKLIKSGPYVAL
TLQGPPPSATSVPLEPLPSDPTPNQRSSLAGEGLPPPPPPLPSGLGSTPSQRITGPKPLQ
DPEVQKHASQILRKMLEQEEAELQVLMEEWLKNPSPSLDERIESAKRRAHQVRVKIQNQE
GTGSESVTNYIQAGEGRLSMDSSEGDLEAFESPSSSPSLSFRTPYHRRQNSDTYTLSDTG
VKAQIISPEDEDEEGDGYAFNEMDGPFQDIELLKSRPAHMTVFMRYVFTQLLDPNPLLFY
LSVEAYLGSAPKDARALAPQICSHFLDPDAPLKIKVREEFLTEIENRLHAQEDIRGPLSE
LQQQVLPDIQDQIQDYRNKQMIGLGSLFGEGDLRQLDGDPLKEKQVVDRQVAALWEILSK
DEEDRSSPLASAVLLYLRHSGIKLRDSKVFLGLSTEKDKWLAFLKPKKPSSVKKEKDGED
KKRNPILKYIGKPRSTSQSTFHVPLSPTEVRPGSVKNIIQQFENHTELPGEEDGDGVDPQ
RLSSSSLGEEGMDSHMVSVRLGRSGSLKAQGEDRRRGTISSGDSVPRSRSDVDMEDCEER
EQPGLRLLQHSASSSASSSSARSLENPTPPFTPRSRRRSVDSQLALLPDAAVLEDEVSDG
QNWRDTVPPELLATLSPKEVERQAVIYELFTTEVSHLRTLRVLDKVFYRKMRSVLNSEEL
ACIFPNLPQVYELHASLCEEMKKRRESPIVQHIGDVMLAKVEGAAGNEFQEQASQLCCQQ
TQALELIKNKKRKDQRFAQIIQECEASPQCRRLQLKDLLVSEMLRLTKYPLLLDKIIKYT
EGGSSDLPSLQRAQACCRGILKAVNEDVRETEHRQRLSQYQRRLDAAPQFKSLDLTTKRM
IHEGPLVWKIGKDKQIEIQALLLSDCLVFLQKGPDDRLLLRYPSRWMGGGGGVITDTKTS
FSPVVKLDSLLVRSVATVDKKALYIISTKETQIYELAAGSPSEKDTWKDLLEKTIKTSSP
QSNHGSLPVSSPSLRSSSPALTEVHPAEEQSEFIGSHASADDDMLGDHLTDQPEANSCDE
DQAVGVAEAALHDVETLRRLILPDEDRRSHDTDDTPTNTMSNGNADGRRQDSLETVLDLC
MSEPEPGQPEAPPPESRQPSAKVVRRGKRIAASAPDGTASDVSLPSDLSSQSRGNVFYLV
MPLDQGESVTDDLPDPPTPTASYFPQPPQEVMSSQTQLEEVGSRPAARSSSTAQQSHVIR
NADEIFLTIEGLMRKLHKLKEIEKAHHKLLESLRDPALSQESEDQACRSATVSRTPSMDR
SSGDGKEGNPGDPRILSTGF
Download sequence
Identical sequences ENSPFOP00000001906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]