SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000001975 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000001975
Domain Number 1 Region: 383-552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-46
Family SPRY domain 0.0005
Further Details:      
 
Domain Number 2 Region: 12-69
Classification Level Classification E-value
Superfamily RING/U-box 9.06e-19
Family RING finger domain, C3HC4 0.037
Further Details:      
 
Domain Number 3 Region: 146-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-16
Family B-box zinc-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000001975   Gene: ENSPFOG00000002122   Transcript: ENSPFOT00000001979
Sequence length 558
Comment pep:novel scaffold:PoeFor_5.1.2:KI519781.1:1142161:1143885:1 gene:ENSPFOG00000002122 transcript:ENSPFOT00000001979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGMEQNQLDRETVSCPICLDLLKDPVTIPCGHSYCMSCIETHWDEEDQRRIHSCPQCRE
TFIPRPAVKKNTMFFFTAKHVEQMRKTGLQAAPADHCYAGPEDVACDSCTGRKLKARKSC
LICLASFCEKHLQPHYDSAAFQKHKLVEPSNNLQENFCSKHDKLLEIFCRTDQKCICYLC
TMDEHRGHDTVSAAAERTERQRELEERRGNIQLRIQDKEKYVKLLQQEVEAINHSADKTV
EDSEKIFTELIRLLQKSSSDVKQQIRSQQETEVSRVRDVHEKLEQEITELKRKDAELEQL
SHTEDHNQFLLNYPSLPAPSESTHSSSINIRPLRHFEDVTAAVSELRDKLLDVLRDSWTN
ISLMVGEVDVLLSEPEPKSRAGFLKYSCEITLDPNTANTKLGLSEGNRKVTRMNQPQSFS
SHPDRFTNYSQVLSRESLTGRCYWEVKWTGFCVSIAVAHKDISRVGDGNECRFGYNDRSW
ALVRFQTDFQFVHNRTRTSISGPVSSRVGVYLDLRAGLLSFYSVSETMTLLHRVQTTFTQ
PLLAGVWVGIGSAEFCKL
Download sequence
Identical sequences ENSPFOP00000001975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]