SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002005 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002005
Domain Number 1 Region: 170-233
Classification Level Classification E-value
Superfamily Homeodomain-like 3.46e-20
Family Homeodomain 0.0031
Further Details:      
 
Domain Number 2 Region: 42-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000025
Family LIM domain 0.017
Further Details:      
 
Domain Number 3 Region: 12-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000121
Family LIM domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000002005
Domain Number - Region: 104-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0826
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002005   Gene: ENSPFOG00000002129   Transcript: ENSPFOT00000002009
Sequence length 306
Comment pep:novel scaffold:PoeFor_5.1.2:KI519782.1:196659:199210:-1 gene:ENSPFOG00000002129 transcript:ENSPFOT00000002009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSVPQSTSHHVKIPCASCGQEIVDRYLLKVNNLCWHMTCLVCSVCKTSLGRHVSCYVKDK
QVFCKLDYFRRYGTRCARCGRNIHSTDWVRRARGSTFHLACFSCSSCKRQLSTGEECGLV
ENRVFCRSHYDIMMESLKRAKENGEHTNGIMLEKEQPKLDDDLANQDDPSAIPRPAKRAR
TSFTADQLQVMQTQFAKDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARQKKHICPIQP
SSTMMTSLGPSQLTPPLMEDLQYTSYLSPDTPLLTTLTYMEVQTPDQLLLQPLMSNSLTQ
LPIGHS
Download sequence
Identical sequences ENSPFOP00000002005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]