SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002043 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002043
Domain Number 1 Region: 199-262
Classification Level Classification E-value
Superfamily Homeodomain-like 4.06e-20
Family Homeodomain 0.0031
Further Details:      
 
Domain Number 2 Region: 82-148
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000119
Family LIM domain 0.017
Further Details:      
 
Domain Number 3 Region: 52-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000136
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002043   Gene: ENSPFOG00000002178   Transcript: ENSPFOT00000002047
Sequence length 336
Comment pep:novel scaffold:PoeFor_5.1.2:KI519782.1:207656:212083:-1 gene:ENSPFOG00000002178 transcript:ENSPFOT00000002047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAQTMSEEDTFTAEEIFSQLHQENAFYDTGSSGADDIFEEASVPQSTSHHVKIPCASCGQ
EIVDRYLLKVNNLCWHMTCLVCSVCKTSLGRHVSCYVKDKQVFCKLDYFRRYGTRCARCG
RNIHSTDWVRRARGSTFHLACFSCSSCKRQLSTGEECGLVENRVFCRSHYDIMMESLKRA
KENEQPKLDDDLANQDDPSAIPRPAKRARTSFTADQLQVMQTQFAKDNNPDAQTLQKLAE
RTGLSRRVIQVWFQNCRARQKKHICPIQPSSTMMTSLGPSQLTPPLMEDLQYTSYLSPDT
PLLTTLTYMEAVQTPDQLLLQPLMSNSLTQLPIGHS
Download sequence
Identical sequences A0A087X8E0
ENSPFOP00000002043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]