SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002095 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002095
Domain Number 1 Region: 393-639
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.13e-61
Family Nuclear receptor ligand-binding domain 0.0000000147
Further Details:      
 
Domain Number 2 Region: 272-349
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-25
Family Nuclear receptor 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002095   Gene: ENSPFOG00000002202   Transcript: ENSPFOT00000002099
Sequence length 642
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519862.1:873916:883051:-1 gene:ENSPFOG00000002202 transcript:ENSPFOT00000002099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKMHGKMSAISTTSIADSTDSKVSNLIDVGYSRSVKVVARNLGSLDPLIHGLNSSGDC
SVYKDCNSIEASVSAKQSYDSNSDYLKSAGVPWEEFVKHQRTSASLSESLSAANLSLSST
PGTCKFIKDEKEPAVIMDTPCPKFDTSPEIRTLDTCCETDSKQHLGLEVIPRPRMEGSPN
FLIELTKPEQLGNSGRTDSRCAVSTHSHSPAPHATSRWQIQTPTSEPPYWLHTAAMTETD
AFPTSSYEGIQNHTQTQRNPSPFSTFPGLQPQRMCVICGDEASGCHYGVLTCGSCKVFFK
RAVEGHHSYLCAGRNDCIVDKIRRKNCPACRLRKCYQAGMMLGGRKLKRFGALKALGLAP
SLMFQSHLAMSGDGQALTSMSCVPSIHELQLSQQIINILENIEPEIVYSGYDNLQPEVPH
LLLNSLNRLCEKQLLWIVKWSKSLPGFRNLHINDQMTLIQYSWMNLMVFSLGWRSFQNVT
SEYLYFAPDLILSQEQMRRSPIYDLCLAIQFIPQEFANLQVTREEFLCMKAIILLTTVPL
EGLKSQAAFEEMRQNYIRELSRAIHMKEKGMVASSQRFYHLTKLMDAMHDIVKKVNLFCL
STFIQADGMKVEFPEMMSEVIASQLPKVLAGMVKPLLFHTKQ
Download sequence
Identical sequences A0A087X8J2
ENSPFOP00000002095 XP_007569999.1.10163 XP_014904664.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]