SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002365 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002365
Domain Number 1 Region: 366-576
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-67
Family Nuclear receptor ligand-binding domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 120-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-29
Family Nuclear receptor 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002365   Gene: ENSPFOG00000002389   Transcript: ENSPFOT00000002369
Sequence length 579
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519796.1:237696:243870:1 gene:ENSPFOG00000002389 transcript:ENSPFOT00000002369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSNAVCSPPPGGVILYAGSSGSASPSPGSPSSGYQTQSPSSHSQPSSPEGVSFQEIGVLK
QRGDHGGGTVSPKMVFQFPEVSNAPVAHVTTPSSATYGHATAAKRSCSFTGTFTKTGGMV
LLCKVCGDIASGFHYGVHACEGCKGFFRRSIQQNIHYKMCVKNENCLIMRMNRNRCQHCR
FKKCLSVGMSRDAVRFGRIPKREKQRLMDEMQSYMNSLNGPASVEMEVPPPSDGPCSPLH
QTNTGSCSLPQSYPSEEKPLKTAAGSSSLGTPSFQSGTVQEAGPSVQQNLNPAQYRVQVE
QQNVSTCYHLAANYPAPPCSNASSTSTNVGNANYYSSHQNRCPVSGSLSSQAFTGSHGVM
PDRDNQNPTSCPWKLNGGAKVLACPLNSCPVAPASRSSQEVWESFSQCFTPAVKEVVEFA
KSIPGFQTLSQHDQVMLLKSGTFQVLMVRFCSLFDPKERTVTFLNGQTYSLASLRALGMG
SLLDAMFDFSEKLGSLGLEQDEMALFMAVVLVSADRSGIVEVGAVEQLQETLIKALRSLI
TSRRPDDGTLFPKLLLRLPDLRTLNNQHSEKLLAFRIDP
Download sequence
Identical sequences ENSPFOP00000002365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]