SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002383 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002383
Domain Number 1 Region: 350-577
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-66
Family Nuclear receptor ligand-binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 116-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-29
Family Nuclear receptor 0.0000211
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000002383
Domain Number - Region: 189-244
Classification Level Classification E-value
Superfamily FlaG-like 0.0942
Family FlaG-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002383   Gene: ENSPFOG00000002479   Transcript: ENSPFOT00000002387
Sequence length 580
Comment pep:novel scaffold:PoeFor_5.1.2:KI519690.1:530351:544713:1 gene:ENSPFOG00000002479 transcript:ENSPFOT00000002387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNSPGGGGGVILYAGSSGSASPSPGSPSSGYQTQSPSSHSQPSSPEEVTFTEIGALRQG
RTTGANTPTSKLVFQFPEVFSASSAAAAPQQPYAHPIAGKRPCGFAGTFTKTGGMVLLCK
VCGDIASGFHYGVHACEGCKGFFRRSIQQNINYKMCVKNENCLIMRMNRNRCQHCRFKKC
LSVGMSRDAVRFGRIPKREKQRLLDEMQSYMNSLNESAAMDMDSSVRDSTISTDDCNSKE
AIGTISKAYRDIFTGNNSHERSSKRAISTSSSSSNNNNASTFSRDGGFQASSHPNSTQSY
QSSPVSHATMCPVASNNNQPAFHKVDNNHYSYLVSTNQNHNQSNTAMGQRISSTNHNSFP
SGEVAQNHPSTCPWKLPPGAKVLACPLNACPVSGAERTSQEIWESFSQCFTPAVKEVVEF
AKGIPGFQELSQQDQVMLLKSGTFQVLMVRFCTLFNAEQRTVTFLNGQTYPLSTLRVLGM
GSLLDAMFEFSEKLGSLGLEPDEMALFMAVVLVSADCSGISDMRAVEQLQEGLIRALRSL
ISRRRPDDSALFSKLLLRLPDLRTLNNLHSDKLLAFRIDP
Download sequence
Identical sequences A0A087X9D0
ENSPFOP00000002383 XP_007556625.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]