SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002777 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002777
Domain Number 1 Region: 350-481
Classification Level Classification E-value
Superfamily C-type lectin-like 6.7e-41
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 2 Region: 640-776
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-33
Family C-type lectin domain 0.0000646
Further Details:      
 
Domain Number 3 Region: 793-921
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-32
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 4 Region: 494-629
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 5 Region: 924-1071
Classification Level Classification E-value
Superfamily C-type lectin-like 1.26e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 1212-1352
Classification Level Classification E-value
Superfamily C-type lectin-like 1.13e-27
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 7 Region: 1082-1206
Classification Level Classification E-value
Superfamily C-type lectin-like 1.58e-26
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 8 Region: 216-341
Classification Level Classification E-value
Superfamily C-type lectin-like 8.35e-26
Family C-type lectin domain 0.0029
Further Details:      
 
Domain Number 9 Region: 27-144
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.05e-16
Family Cysteine rich domain 0.0036
Further Details:      
 
Domain Number 10 Region: 145-201
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000237
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002777   Gene: ENSPFOG00000002676   Transcript: ENSPFOT00000002781
Sequence length 1453
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519637.1:111551:128311:1 gene:ENSPFOG00000002676 transcript:ENSPFOT00000002781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLRIALAALVLLVLALQGSTTLINDSPFILMNKATGFCLAKRGTRCTEIRWTTSNRLF
VVSTKKCLGAQGKSVGSEVSQYDCDENSDLQKWDCQNGTLLTLKDQPFYIEVKTDESVVL
SKTVGPNNHLTIAGTSSGACTRTHREYYTIGGNSFGKICMFPFMYKDRWYGDCTTYDSKT
KRSWCATETKYQHEQWGYCPSSCKFTCTATDHWNRNIVTGAYYQVNMQSALTWAQADASC
KQQAAFLVSIVDPIEKAFITGRCRTGRNKLWIGLSLGTEHGWQWTDRKPFRYIKWDAGHP
LPNPGHNCALLDTAGQFSWQSSTCTKKLGYICYKGGTPPAPPRCTENYSVEDGLCPDHWI
PYNGHCFYLQRTPKSWSSALTECRKQGSELVNIRNIEDQSFVISQLGYASTDELWIGLND
RTTEGLFDWSDHTTVTFTSWEPEEPTVSTDEEDCVLMKGENGNWADRSCDEKHGYICMKQ
SATDGTGDVIELHLDAGCKIGWRRHGSFCYFVGTETKTFDEAKEDCQSSASYLADVSNGV
DNAFLVSLVGLRPEKHFWIGLSNQNNLDIFSWTNTEFVRFTHWNSGMPGNQQGCVAMATG
VSAGLWDILPCTNKEKYICKCMAEGVVSTVPPQTQTPPQCPDGWNRVGTRSVCAKVITGP
RSEEKTWFEARDYCRAIGGDLLSIHSSSELMVARYINRGGKAWIGLHFENPNGYVWTDGS
ALNFQHWQEGEPNNFNNDESCTEFVMYNWDEQGSWNDLNCESYNDWLCQIQAGRATLKPP
PNNTAAEFNTTSDGWLIWKGRQYYLNRMAKSMEEARDFCKRRHGDLVVINNKEENIFLWK
QISRGYGAWFIGLSVDLDGSFWWLDDTPVSYQRWDENQPNSNAFDENCVTMGYHMGYWRT
SNCGREAQSICERSNSPPVNTTAAPTVSLIGGCLATWKKFGSKCYKIVSDRKVTWEDART
QCANFDAKLVSIPTRQVQAFLITKMLTAANTDLWIGLNSLSQDGFFWSDGKTRQYTNWGY
SKNQRRPGSFYQRWNEEECVLMSSSSAFGIGKWLIKSCNDTNGFICHKDLNTAIKDNSDP
ISPTTYESLGNDSIKAVTQNLTWAEAKKSCENDKANLASLRTEWTNAYVELLALTLKTPL
WIGLNKDETNGYFRFIDGWHLSTTNWAEFEPSRNKPCVYIDVDGKWRTAFCNQTMNSVCM
MSTGVTDVAPTESVVFPGRCPEDTNVEYQDSYTWLPYKGNCYLFVTDEIEWADAASSCVR
HGGVLTSIEDPMEQAFLHSNIQVFQDSHASFWVGLFKTHRGSWAWLDKTLLDYVNWGEDE
PDSDFGAITTKDGTWSSGRRWHDRSYICKTPKDAGQKPTYPCLLVACADPQPGDDPHSRV
HTSLVVAMLIAIISIMTLFAFLLYKRSPRPFPTFDNPLYFNGEKSQPDVVDTNKLIENAE
VSEISPENPEPIL
Download sequence
Identical sequences ENSPFOP00000002777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]