SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000002957 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000002957
Domain Number 1 Region: 227-351
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.67e-58
Family Dystroglycan, domain 2 0.000002
Further Details:      
 
Domain Number 2 Region: 512-612
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000471
Family Dystroglycan, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 110-204
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000518
Family Dystroglycan, N-terminal domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000002957   Gene: ENSPFOG00000003094   Transcript: ENSPFOT00000002961
Sequence length 907
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519700.1:133677:148299:1 gene:ENSPFOG00000003094 transcript:ENSPFOT00000002961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPSRLFTDICCAAQRPLDMHYILRDMSCRYAGRSRFPSCRTLPVVIWLLATLAHGAVPD
QQETLVDMISVELEASMQSSVMSELQAAASSVGEGPPTTVPESSVGNGVHTNIPDSSAIV
GQVFQLKVPPGPDHACCNVQLTEMGRETLPSWLYWDKERCTLRGLALEQDKGVYHILVSG
EQITEGTSSQVYPSTVFTVEVYPEERADTEPALLTLQSDISGLQPFTCGSEEPVTVLTVI
LDADLTKMVAEQRVSLLGLMRKFSHVPLEHMRVVPVVNNRLFDMSAFMAGPGNAKKVVEN
GALLSWKVGCALDQPSIPDISSVQSSAKDGTMSARLGYPVVGWHIVNKKPHVVKRIRRQL
YNTPTPVPSLLPPTVNQEPLSRVVPTPTSPAIAPATDNSTPPVRGPLPLPVKPTLRVKDQ
IAHTPVFGPPQPTRVLGTTSTIPIMPTMTRPTILGPTASPTPPGAGKKPKPSKKPKKPKM
STPAPREPKSTTPKTTIRTTTLSLTTDLNQNPEIRNPIDQVKAWVGTYFEVKIASDAFYD
REDGTTDKLRLTLKKTPKEAVSETSWIQFNSSIQLLYGLPDEEHEGNHEYFMLATDKGGK
SIVDAFEVQVNRWTSNDKPSVVFAARFHGDPKTLSENVHNKILLTKKLAYALGDRNTSTV
TLRSITKGSIVVEWTNNSIQQNFCPKEQITTLTKRISDSQGTPSPAFIKAMEPEFKPINI
SVRGTNKCQSYTFIPPGEVPIPALPTATPSPGTSQRSSDDVYLHTVIPAVVVAALLLIAG
IIAMVCYRKKRKGKMTIEEQATFIKKGVPIIFADELDDSKSPPSSSIPLILQEEKPPLPP
PEYPNMAGPHSTLLNQDLLEEYSAYQDDDPNAPPYQPPPPFTVPIEGKGSRPKNMTSYRS
PPPYVPP
Download sequence
Identical sequences A0A087XB04
ENSPFOP00000002957 XP_007557674.1.10163 XP_016529611.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]