SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003356 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003356
Domain Number 1 Region: 96-107,208-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-50
Family Nuclear receptor ligand-binding domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 24-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003356   Gene: ENSPFOG00000003412   Transcript: ENSPFOT00000003362
Sequence length 461
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520805.1:3223:9423:1 gene:ENSPFOG00000003412 transcript:ENSPFOT00000003362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTGRKADECTCVDMNFPCEVDLEEQCPVCGDKVSGYHYGILTCESCKGFFKRTVQNNKTY
VCVENQQCKIDTSKRKRCPFCRFQKCLNVGMRLEAVRADRMRGGRNKFGPMYKHDRALKQ
QKKALIQARRLRIESNQKDVTFTSNIHSIAILHNTKLNPNQLPSQPCNSPAVLQHQITSP
TNWAMKLENCSNSVELAALAEAIIGPHHTSSRSISTQSPRIPQLEIEFLHCDPHDLQLQK
NIFSCLQQEQACRHREPSTFSSVYVMADQLLCSIVEWARTSIFFKELKVSDQMKLLHSCW
SELLVLEIISRQVLYGTDGGLLLISGQQGELSYVASHAGPTLVSLNQRGTELVEKFRMLK
VDHQEFACIRFLILFAPDVKELEEHRFVESVQQQVEGALLKYTLASSSQSCNRFTCLQLY
LSELHSLSILAEDYLYYKHLSGEVPCNNLLNEMLHAKCCWT
Download sequence
Identical sequences ENSPFOP00000003356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]