SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003636 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003636
Domain Number 1 Region: 210-486
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.27e-76
Family Mitochondrial carrier 0.00011
Further Details:      
 
Domain Number 2 Region: 32-186
Classification Level Classification E-value
Superfamily EF-hand 5.4e-36
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003636   Gene: ENSPFOG00000003607   Transcript: ENSPFOT00000003643
Sequence length 494
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519825.1:76991:85104:-1 gene:ENSPFOG00000003607 transcript:ENSPFOT00000003643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCRTDGASARCFYNSSAMYQALRTSLLSSALCWDADSVRSYQVLFDKLDTNKDGKVDVA
ELRVGLKAMGIFRHGAAQKIVSSGGQNNDGSLDFNEFTKYLKDHEKKLLLTFKSLDRNND
GHIDATEIQQALAELGIHVSREDAQKILQSMDIDGTMTVDWNEFREHFLLYPAYNLEEII
RYWKHSSVLDIGDSLSIPDEFTEEEKRSDEWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQ
VHSSAANKISLIGGFRQMIVEGGLTSLWRGNGINVLKIAPETAFKFMAYEQQYKKLLTSE
GTKIETHKRFMAGSMAGATAQTAIYPMEVLKTRLTLRKTGQYAGMFDCAKKILRKEGVIA
FYKGYIPNLIGIIPYAGIDLAVYETLKNTWLSHHTKDSANPGVLVLLGCGTISCTCGQLA
SYPLALIRTRMQAQASLDVSDQPSMSSLLRTIVAKDGFFGLYRGILPNFMKVIPAVSISY
VVYEYMKTGLGLSK
Download sequence
Identical sequences ENSPFOP00000003636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]