SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003650 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003650
Domain Number 1 Region: 468-637
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-46
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-19
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 150-211
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000113
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000003650
Domain Number - Region: 264-349
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003650   Gene: ENSPFOG00000003786   Transcript: ENSPFOT00000003657
Sequence length 644
Comment pep:novel scaffold:PoeFor_5.1.2:KI519925.1:1889:12937:1 gene:ENSPFOG00000003786 transcript:ENSPFOT00000003657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSKQEDQLAQELSCPICLQLYNDPVVLPCGHNYCRACISKSADSIDSGKEPLRCPECR
EAYHGVDTLQKNFKLSNIVEGFQASSQNIYEEIQDVIKPTNPDADDVIFCDQCIDDKTPA
VKTCLKCEVSLCFRHLQKHNERESFKTHSLVEPLKDLGSRACPVHNLPLEYFCSNDMRSL
CITCLEGHDQNHDVLTFSVAEEEMRRALESRSKVVSSRLQLTECLLQKTQEDQGASEAVG
DKMVNKAVSLMDSMAAIVDRIKANSFQNTAGTHHNNTCLNVMYRVRTNEQAQNKSHSLLK
KLIYTTFRERLRLLLEEERGQRRKSWQLGVSALEEQQQQLQEAQKSASKALSETDTCAFI
HRYKHNLSYFLLSDSFSQMMILNLRLKKNSAGYALKNSFTCKNRYLFIRFMMIEQKLRDA
ATGSLPSTIPSKVDLNTKRLQTDLKTNDFRTEMVRLLDTLHILLNPLEVTFNVCTAHPSL
LVSNDLHTVRCTSSKQSYVEHPERFLSAPQILCSQGFSRGTHIWVAEMGSNCMWSLGACY
KSIPRRGDHSRLGHNLVSWRLQWKNGKLTACSSSSNAVLGEVFQYPSKIEVVLDCEGGTL
SFHTIKSRREHLYTFKTVFKEPVYPAFSIHSNTSESWITLHSQM
Download sequence
Identical sequences A0A087XCZ7
ENSPFOP00000003650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]