SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000003882 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000003882
Domain Number 1 Region: 368-549
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-61
Family SPRY domain 0.00000693
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily RING/U-box 3.95e-20
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 144-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000397
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000003882   Gene: ENSPFOG00000003651   Transcript: ENSPFOT00000003890
Sequence length 560
Comment pep:novel scaffold:PoeFor_5.1.2:KI519740.1:495140:499820:-1 gene:ENSPFOG00000003651 transcript:ENSPFOT00000003890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYALSEEQVLCVICMDSFNDPVSIPCGHNFCLECIKGFWDASHKSECPLCKESFQTRPD
LRVNIVLKDITEQFKRRKQASRPEPAPRKNSSRRSLKADSVTCDICSEDKLTAVKSCLVC
QASYCEMHLVPHLRDPVMTKHRLTDPATFSTSHLCRNHNKPLEMFCKKEQTPVCASCTER
DHKHHEVVPMEKESRRVKAQLKVVQAEIQEMIQTRLKKTEEIKNSVELSRIEKEKEIQTS
VHVANLAINAIERNQALLIEELEEKHEAAKRRAEDLLEELDQELGELQRRRSELQYLENT
KDPLHLLQSFPCLSSPLSTTNWSEVSVDPDIYIRRVRTTFSKLVDLCQELEKNLCAEGEI
NIVYIYPSSVDVTLDPATAASWLLLSPDGKKVSLSSQQRKHALPNNSRRFDSCVAVLGKQ
SFTSGRRYWVVKVGDKTDWDLGVAKESINRKGSITVRPDSGYWAICRRKGESLRACAGPS
VVLNLHEIPTKVGIFLDYEEGSVSFYNADAKTHIYTYKGCCFSEPLYPYFNPCLHDNGRN
TAPLIICPVETGFTVESTVN
Download sequence
Identical sequences ENSPFOP00000003882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]