SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004040 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004040
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000433
Family V set domains (antibody variable domain-like) 0.015
Further Details:      
 
Domain Number 2 Region: 167-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000529
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 3 Region: 257-332
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000367
Family C2 set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004040   Gene: ENSPFOG00000004174   Transcript: ENSPFOT00000004048
Sequence length 403
Comment pep:novel scaffold:PoeFor_5.1.2:KI519911.1:197833:204437:-1 gene:ENSPFOG00000004174 transcript:ENSPFOT00000004048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDSVALAPGQSFNIISSVTWKRQTDLALQWFGGDITCYRDFKGRCDLDIESGSLIINNLT
LDDSGSYTFDINNSVLDKKDLRVIKPVPKPTVSVDCNNEKTVCNLTCEANITSEFGPVTY
TWQTGDTELSNDKEDNKESSFSCMLRNPISINSSEEVSKPVSRAVMIYAKVGDSVVLHPG
RSFDNITSISWGHEMSPILEWFGQDIILYKSHKGRSDLEKTTGSLIIHNLTVEDTGRYTP
EINRLSHNPVVLQVIEPVPKPMVHLKCNPRKTLCDLTCKANTSSRFGPVMYRWEAGNKVV
STDNQLSLTTKNQSRAYTCKVKNPVSTSSSDEVATPIKFIHGGNNFYPSVVVPVVLVVLV
LVVAGGYVKHRKGFLGQKQQKRMSLEDEEQRLHDDQELKKQSQ
Download sequence
Identical sequences A0A087XE37
ENSPFOP00000004040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]