SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004076 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004076
Domain Number 1 Region: 34-158
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-23
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 501-597
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000123
Family SH2 domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004076   Gene: ENSPFOG00000004143   Transcript: ENSPFOT00000004084
Sequence length 603
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520274.1:231018:239833:1 gene:ENSPFOG00000004143 transcript:ENSPFOT00000004084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYLNPSVFMQKSVPASMELYLSLTVIITMSFPEMYWPVPMRAIGAQNLLTMPGGVSTSG
YLHKKGGSQFSLMKWPLRYIIIHKGCVYYFKSSTSPSPQGAFSLNGYNRVMRAAEETTSS
NVFPFKIVHFSKKHRTWYFSAASEDERRKWMRFLRREIDHYNDRKEAQISSSDSDSDADF
YGTIERPMEIKHAVDTAEDDYVDEDDDEEDEEDYLKPDGDGSPTSPGRPTGPPPSYPPPP
VPATPLRRESSPNIQKAVPLPVPGQHRNPSSPLPKKPSIPHQPLQKEQSKGPPPPLPFAP
HLQKSPSPTPPALPPSSLKTAQNRTISLGNTANDRRDLRSHSTVQVHSPATLPICDQLHN
RMVLNGPVNSSPNTGSTQSLGNHCLRTKPSLPLPHTEVNLLSTSAPSLPAKPPSSPLLKS
GLHNKPTIPKPPPPTAKPPQTLDKPKSPFHKQLEIRASPDGQSFRSLGEEIPADIRKKPK
SSKHEHDSDDDYENVQLPESVFIDSTETIFVEKLFKECCANPPDGLYGIRKSGTKTAKVL
VVWDVAINKARNYRLFEENDSIFLESDLTFPNLAALVEHYYSHPLPHHGSLCLQKPYAKV
LSS
Download sequence
Identical sequences ENSPFOP00000004076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]