SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004267 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004267
Domain Number 1 Region: 30-315
Classification Level Classification E-value
Superfamily L domain-like 6.8e-62
Family Ngr ectodomain-like 0.0024
Further Details:      
 
Domain Number 2 Region: 234-473
Classification Level Classification E-value
Superfamily L domain-like 3.23e-39
Family Ngr ectodomain-like 0.049
Further Details:      
 
Domain Number 3 Region: 527-838
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.65e-25
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004267   Gene: ENSPFOG00000004179   Transcript: ENSPFOT00000004275
Sequence length 990
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519670.1:43321:75814:-1 gene:ENSPFOG00000004179 transcript:ENSPFOT00000004275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVDLFWICLWCFIRPSASGQGQSTAVCSPSCSCDEDGGADCSGRGLTTVPTGLSTFTYY
LDLSMNNITELPAYVFKKFPYLEELRLAGNDLTFIHPDALSGLHQLKVLMLQNNQLKSVP
NAALKNLHSLQSLRLDANHITTVPDDSFEGLQQLRHLWLDDNHLTDVPVSSLRHQSNLQA
LTLALNRILYIPDNAFGNLTSLVVLHLHNNRIKEIGANCFVGLVNLETLDLNFNNLKEFP
KAIEALPKLKELGFHSNDIAAIPERAFHNNPMLRTIHFYDNPLSFVGASAFQNLSDLRSL
MLRGASLMKDFPILTWTNNLDSLTLSGTKISSIPADLCEDLKFLQTLDLSYNEVKQLPSF
QGCSRLQEISFQHNHIQQIDRDTFQDLSALRLLDLSRNEIRVIHKDAFLSLTGLTNLDLS
MNSLSVIPTTGLSAVIQLKLSGNPQMKNVLPAKNLPKLRSISVPYAYQCCAFIGCDSVTR
SAEQTDVKKSTGGNERSFCFCAVVGVEGGEQVSMIMHCSPSPGAFKPCEHLLGNWMIRLT
VWFICLVSLVFNSLVLVTTFSPAHRAAGYSHYLTPSLSPARLLMGLLALANLLTGLYVGI
LTVLDAATWGSFAEFGAWWEMGPGCQITGALAVFSSEWSVLLLALAAVERSMAVRMILGK
VLMSPRRNGSSHRRCFRGYQCFGLAAGLLGLLAAAGACLPLLTFSDQSSSPLCLPFAGGE
SPALSVTVILVLLNALAYLFTAAVYTQLYCHLGRVELADPEQTGALRHVAWLIFTNCIFF
CPVAAFSFAPLLTGSTAGGPEIAKSVTLIFFPLPACLNPVLYVFFSPAFREDWLRLHGHM
DLTQEVKAGTESGCDDGGGGSELTDEGSFSHLGFDCGVYSQLCGETVCEQCEAVLRARTC
SSPSASSVCRHLVKSHSCPTLLAGAAICPRSEGFWADSGTPSAQSEYADEGDSFVSDSSD
QVQACGRACFCQSRGLPLVHYSYNIPRVKD
Download sequence
Identical sequences ENSPFOP00000001367 ENSPFOP00000004267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]